logo[мetahunt]
> DOU
senior

AI Engineer

NCube Ltd.
format:Remotetype:Full-timecompany:Outstaff
pythonllmgenerative airagai agentsmachine learningsql
langgraphlangchainmcpmulti-agent systemslitellmvllmsagemakeraws bedrocklangsmithaws
englishB2
experience5+ years
domainHealthTech
> full description
Experience
5+ years Core Skills
Python, LLM/GenAI, RAG/Agents, ML Candidate’s location
Europe, Ukraine Work Model
Remote Engagement
Full-time, long-term English
Upper-Intermediate+

We are looking for a Senior AI/ML Engineer to join our client’s newly formed R&D team working on an established technology platform that supports health programs across multiple African countries. You will work within a high-ownership agile team to design, build, and operate production AI/ML solutions focused on risk and fraud prevention, combining strong software engineering and data foundations with hands-on expertise in traditional machine learning, Generative AI, LLMs, RAG, and agentic systems.

About the client — an international nonprofit organization focused on strengthening the health and resilience of girls across Africa. The client operates a technology-enabled ecosystem connecting community organizations, healthcare providers, and other local partners.

About the project — the team will contribute to the further development and orchestration of an existing production platform, with the longer-term goal of making the technology more extensible and suitable for use beyond the current programs. As a Senior AI/ML Engineer, you will take ownership of AI/ML solutions from design and development through deployment, monitoring, and optimisation.

Must have:

  • 5+ years of professional experience as an ML Engineer, AI Engineer, Data Scientist, Software Engineer, or similar role, with a strong track record of shipping production software
  • Strong proficiency in Python and experience writing clean, maintainable, production-quality code
  • Strong SQL skills and hands-on experience working with large-scale structured data
  • Proven experience building and serving LLM-based, GenAI, or agentic systems in production for real users, beyond prototypes or PoCs
  • Hands-on experience designing and building RAG pipelines, including chunking strategies, retrieval design, and evaluation
  • Experience with agentic AI workflows, including multi-step reasoning, memory, tool integration, and agent orchestration
  • Solid foundation in traditional machine learning, with strong expertise in at least one area such as tabular ML, classification, regression, ranking, NLP, or deep learning
  • Good understanding of production AI/ML systems, including evaluation, monitoring, latency, throughput, scalability, reliability, and cost optimisation
  • Strong systems thinking and understanding of how distributed components interact, degrade, and fail
  • Ability to work independently, move quickly through iterative feedback loops, and take ownership of business outcomes
  • Strong verbal and written English communication skills
  • Good to have:

  • Hands-on experience with LangGraph, LangChain, or equivalent agentic AI frameworks
  • Experience with Model Context Protocol (MCP) and multi-agent systems
  • Experience deploying and operating LLM services using LiteLLM, vLLM, Amazon SageMaker, Amazon Bedrock, or similar technologies
  • Experience with GenAI observability, evaluation, and drift detection tools such as LangSmith, Evidently, or RAGAS
  • Strong hands-on experience with AWS
  • Experience with MLOps automation, containerisation, and CI/CD for ML systems
  • Domain experience in Risk, Fraud, Credit, Insurance, Cybersecurity, or FinTech
  • Experience mentoring engineers or contributing to the technical community through blogging, public speaking, or knowledge sharing
  • Responsibilities:

  • Design, build, deploy, and debug sophisticated agentic AI workflows, including multi-step reasoning, memory integration, tool usage, and multi-agent orchestration
  • Architect and continuously improve RAG pipelines, optimising chunking strategies, retrieval quality, and end-to-end evaluation
  • Deploy and operate LLM-based services in production, optimising runtime latency, throughput, reliability, and cloud costs
  • Develop and maintain traditional machine learning models for risk, fraud, and behavioural pattern detection
  • Build evaluation and monitoring mechanisms around AI/ML systems to understand performance and failure modes
  • Write clean, idiomatic, and production-quality Python code that integrates with existing software and data engineering systems
  • Query, manipulate, and process structured data at scale using SQL.
  • Contribute to the design and evolution of scalable, secure, and resilient AI/ML architectures
  • Collaborate closely with engineers and other team members in an agile, international environment
  • Participate actively in team rituals, technical discussions, and iterative solution design
  • Create and maintain clear technical documentation and contribute to a culture of shared learning
  • Take end-to-end ownership of technical solutions and continuously improve their performance in production
  • We offer:

  • Competitive salary with the regular review
  • Medical Insurance after 3 months probation period (can be used in Ukraine)
  • Vacation (up to 20 working days)
  • Paid sick leaves (10 working days)
  • National Holidays as a time off (11 days)
  • Online English courses
  • Accountant assistance and legal support
  • Flexible working schedule, remote, office-based or hybrid format
  • Fully-equipped office space located in the city center and ready for work during blackouts
  • Direct cooperation with the customer
  • Dynamic environment with a low level of bureaucracy and great team spirit
  • Challenging projects across diverse business domains and a variety of technology stacks
  • Communication with Top/Senior-level specialists to strengthen your hard skills
  • Online and offline teambuildings
  • Volunteering culture development and support
  • Відгукнутись на вакансію