logo[мetahunt]
> DOU
senior

Backend Engineer

Qubit Labs
format:Remotecompany:Outsource
laravelphpmysqlredisgitphpstan
symfonyawsdockergoelasticsearch
test task:yes
englishC1–C2
experience4+ years
domainAdTech
> full description

Our client is a global marketing technology leader providing an AI-native customer engagement platform that integrates data, personalization, and journey orchestration for over 1,500 team members across 30+ offices worldwide.

What You Will Do
● Design, develop, and maintain scalable backend services and RESTful
APIs using Laravel within a modular monolith architecture.
● Build and enhance multi-tenant SaaS features, ensuring proper data
isolation and tenant-aware functionality.
● Write clean, well-tested, and maintainable code following
Domain-Driven Design (DDD) principles, including Entities, Repositories,
Managers, and DTOs.
● Collaborate with cross-functional teams to deliver new features and
continuously improve existing functionality.
● Participate in code reviews, providing constructive feedback and
maintaining high code quality standards.

● Work with code quality tools such as PHPStan, Rector, and Pint to ensure
codebase consistency and reliability.
● Optimize database queries and implement caching strategies using Redis
to improve performance.
● Troubleshoot and debug production issues, implementing robust and scalable
solutions.
● Contribute to technical documentation and participate in architectural
decisions.
● Leverage AI-powered development tools to enhance productivity and
improve code quality.

What You Will Need
● Have a Bachelor’s degree in Computer Engineering or a related field.
● Have 4+ years of software development experience.
● Have strong hands-on experience with Laravel (must-have); familiarity with
Symfony is a plus.
● Have solid PHP knowledge, with experience in modern PHP practices (PHP
8.x features, strict types, readonly classes).
● Have experience with package-driven development, modular monolith
architecture, and Domain-Driven Design (DDD) patterns.
● Have a good grasp of MySQL and Redis; experience with Elasticsearch or
other NoSQL technologies is a plus.
● Be proficient with Git and familiar with Git workflows, including branching
strategies, code reviews, and CI/CD pipelines.
● Have experience with code quality tools such as PHPStan, Rector, or similar
static analysis tools.
● Have experience contributing to large-scale projects and collaborating
effectively within technical teams.
● Have a level of English proficiency sufficient to analyze and understand
technical documentation
● Experience with AI-powered development tools such as Claude Code,
GitHub Copilot, Cursor, or similar AI coding assistants. (Nice to have)
● Hands-on experience with AWS (EC2, S3, SQS, or similar services). (Nice to
have)
● Hands-on experience with Docker and containerized development
environments. (Nice to have)
● Interest in or exposure to Go (Golang), with motivation to deepen expertise.
(Nice to have)
● Experience with multi-tenant SaaS architectures. (Nice to have)
● Familiarity with queue systems such as Laravel Horizon or Redis queues.
(Nice to have)

Working conditions:

  • Remote work;
  • 5-day working week, 8-hour working day, flexible schedule;
  • All public holidays are days off;
  • Vacation and sick leave are covered by the company.

Interview process:

  1. HR interview with the client;
  2. Test assignment;
  3. Technical interview;
  4. Final interview.
Відгукнутись на вакансію