> DOU

Full Stack Engineer

SCIMUS

company:Outsource

pythonfastapireacttypescriptvitetailwind csspostgresqlaws rdspgvector

llmclaude apiaws bedrockembeddingsopenaiasrttselevenlabsaws cognitostripe

domainHealthTech

locationLviv, Ukraine

> full description

SCIMUS is a software development outsourcing company with 10+ years of experience, helping businesses scale their engineering capacity across industries such as Healthcare, eCommerce, AdTech, and more. We’re proud of our delivery track record: 95% of projects delivered on time, a 92% Net Promoter Score, and 9 out of 10 clients returning for repeat work.

We are looking for a Full Stack Engineer to join an AI-powered coaching platform in the healthcare domain.

What You’ll Do:

Build and maintain backend services using Python and FastAPI
Develop user-facing features with React and TypeScript
Work with PostgreSQL and pgvector to support application and AI-related use cases
Integrate AI, voice, and third-party services into the platform
Collaborate with the team on architecture, implementation, testing, and production delivery

Requirements:

Strong backend development experience with Python and FastAPI
Strong frontend development experience with React and TypeScript
Experience with modern frontend tooling and UI libraries, including Vite, Tailwind CSS, and Radix UI
Strong experience with PostgreSQL, preferably Amazon RDS
Hands-on experience with pgvector for vector storage and similarity search

Nice to Have:

Experience integrating LLMs, particularly Claude via the Messages API; experience with AWS Bedrock is a plus
Experience working with embedding models, such as Voyage AI or OpenAI text-embedding-3
Experience integrating speech-to-text solutions such as Deepgram
Experience integrating text-to-speech solutions such as ElevenLabs
Familiarity with AI avatar platforms such as HeyGen or Tavus
Experience implementing authentication flows, including custom authentication solutions and pylti1p3 / LTI 1.3; familiarity with Amazon Cognito is a plus
Experience with Stripe integrations for billing and payments
Experience building asynchronous job processing using Amazon SQS and worker services
Hands-on experience with AWS services, including ECS Fargate, RDS, S3, CloudFront, KMS, and Secrets Manager
Experience with infrastructure as code using Terraform
Experience with observability and monitoring tools such as CloudWatch, Sentry, and Langfuse
Experience with automated testing using pytest and Playwright

What We Offer:

You can fully realize your potential in a supportive environment where your experience is valued.
We believe in continuous learning and development — you’ll have access to a library, weekly tech talks, and course compensation (including English classes);
If you love sharing knowledge, we’ll fully support you!
20 days of Paid Time Off;
A friendly, open atmosphere free from unnecessary bureaucracy, with a team that has a great sense of humor, where creativity and initiative are encouraged.
Regular team events, including Friday pizza parties.