> DOUSCIMUS
Full Stack Engineer
company:Outsource
pythonfastapireacttypescriptvitetailwind csspostgresqlaws rdspgvector
llmclaude apiaws bedrockembeddingsopenaiasrttselevenlabsaws cognitostripe
> full description
SCIMUS is a software development outsourcing company with 10+ years of experience, helping businesses scale their engineering capacity across industries such as Healthcare, eCommerce, AdTech, and more. We’re proud of our delivery track record: 95% of projects delivered on time, a 92% Net Promoter Score, and 9 out of 10 clients returning for repeat work.
We are looking for a Full Stack Engineer to join an AI-powered coaching platform in the healthcare domain.
What You’ll Do:
- Build and maintain backend services using Python and FastAPI
- Develop user-facing features with React and TypeScript
- Work with PostgreSQL and pgvector to support application and AI-related use cases
- Integrate AI, voice, and third-party services into the platform
- Collaborate with the team on architecture, implementation, testing, and production delivery
Requirements:
- Strong backend development experience with Python and FastAPI
- Strong frontend development experience with React and TypeScript
- Experience with modern frontend tooling and UI libraries, including Vite, Tailwind CSS, and Radix UI
- Strong experience with PostgreSQL, preferably Amazon RDS
- Hands-on experience with pgvector for vector storage and similarity search
Nice to Have:
- Experience integrating LLMs, particularly Claude via the Messages API; experience with AWS Bedrock is a plus
- Experience working with embedding models, such as Voyage AI or OpenAI text-embedding-3
- Experience integrating speech-to-text solutions such as Deepgram
- Experience integrating text-to-speech solutions such as ElevenLabs
- Familiarity with AI avatar platforms such as HeyGen or Tavus
- Experience implementing authentication flows, including custom authentication solutions and pylti1p3 / LTI 1.3; familiarity with Amazon Cognito is a plus
- Experience with Stripe integrations for billing and payments
- Experience building asynchronous job processing using Amazon SQS and worker services
- Hands-on experience with AWS services, including ECS Fargate, RDS, S3, CloudFront, KMS, and Secrets Manager
- Experience with infrastructure as code using Terraform
- Experience with observability and monitoring tools such as CloudWatch, Sentry, and Langfuse
- Experience with automated testing using pytest and Playwright
What We Offer:
- You can fully realize your potential in a supportive environment where your experience is valued.
- We believe in continuous learning and development — you’ll have access to a library, weekly tech talks, and course compensation (including English classes);
- If you love sharing knowledge, we’ll fully support you!
- 20 days of Paid Time Off;
- A friendly, open atmosphere free from unnecessary bureaucracy, with a team that has a great sense of humor, where creativity and initiative are encouraged.
- Regular team events, including Friday pizza parties.
More About SCIMUS
🔗 Company site: https://thescimus.com
🔗 Company profile on DOU: https://jobs.dou.ua/companies/scimus-solution/
If you want to grow, contribute, and work in a friendly, creative, and ambitious team, we’d love to hear from you!
Відгукнутись на вакансію