logo[мetahunt]
> DOU
senior

Full Stack Engineer

SIXT
format:Remotetype:Full-timecompany:Product
javaspringreacttypescriptkafkaaws
locationKyiv, Ukraine
> full description

We are modernizing several of SIXT’s business-critical core systems by replacing legacy vendor solutions with in-house platforms used across the whole company. We are now transitioning from external/legacy solutions into fully owned internal systems, and you will play a key role in redefining how these systems are designed, built, and operated.

If you want to help shape the next generation of these platforms and contribute to a large-scale transformation program, apply now.

Your role at Sixt:

  • You understand business processes behind systems and translate them into scalable in-house solutions, not just code implementations
  • You contribute to the modernization of legacy systems into internal platforms as part of a broader transformation initiative
  • You design and develop end-to-end distributed systems across backend (Java) and frontend (React/TypeScript)
  • You work on event-driven architectures using Kafka and cloud-native technologies (AWS-based environments)
  • You build and evolve APIs (including gRPC-based services) and UI components within a microservices ecosystem
  • You act as a senior contributor in a governance-oriented team that enables engineering teams through standards, architecture and technical guidance

Your skills matter:

  • Technical Background Strong experience with Java, Spring Boot, React, and TypeScript in complex production environments
  • Experience Proven background in designing and building cloud-native, distributed systems on AWS or similar cloud providers
  • Domain Knowledge Deep understanding of microservices architecture, ideally with hexagonal or clean architecture principles
  • Tools & Platforms Solid experience with event-driven systems and messaging technologies such as Kafka
  • Practices Hands-on experience with modern engineering workflows and agentic tools such as Claude Code or Cursor, used intentionally to improve delivery quality and speed
  • Background Experience in legacy system modernization, data migration, or transformation programs in enterprise environments is a plus

What we offer:

  • Competitive high salary (pegged to EUR)
  • Full-time employment as an internal employee of SIXT TECH Ukraine
  • Relocation compensation
  • People-oriented management with minimal bureaucracy
  • A challenging role where you can learn, grow, and influence architecture and processes
  • 25 calendar days of paid vacation
  • Educational budget for courses, conferences, and certificationsMedical insurance
  • Co-funding (50%) for gym and foreign language classes

If you want to work with modern data tech, real business impact, and a global product at scale — we’d love to hear from you.

Відгукнутись на вакансію