> DOU
senior
SIXTFull Stack Engineer
format:Remotetype:Full-timecompany:Product
javaspringreacttypescriptkafkaaws
> full description
We are modernizing several of SIXT’s business-critical core systems by replacing legacy vendor solutions with in-house platforms used across the whole company. We are now transitioning from external/legacy solutions into fully owned internal systems, and you will play a key role in redefining how these systems are designed, built, and operated.
If you want to help shape the next generation of these platforms and contribute to a large-scale transformation program, apply now.
Your role at Sixt:
- You understand business processes behind systems and translate them into scalable in-house solutions, not just code implementations
- You contribute to the modernization of legacy systems into internal platforms as part of a broader transformation initiative
- You design and develop end-to-end distributed systems across backend (Java) and frontend (React/TypeScript)
- You work on event-driven architectures using Kafka and cloud-native technologies (AWS-based environments)
- You build and evolve APIs (including gRPC-based services) and UI components within a microservices ecosystem
- You act as a senior contributor in a governance-oriented team that enables engineering teams through standards, architecture and technical guidance
Your skills matter:
- Technical Background Strong experience with Java, Spring Boot, React, and TypeScript in complex production environments
- Experience Proven background in designing and building cloud-native, distributed systems on AWS or similar cloud providers
- Domain Knowledge Deep understanding of microservices architecture, ideally with hexagonal or clean architecture principles
- Tools & Platforms Solid experience with event-driven systems and messaging technologies such as Kafka
- Practices Hands-on experience with modern engineering workflows and agentic tools such as Claude Code or Cursor, used intentionally to improve delivery quality and speed
- Background Experience in legacy system modernization, data migration, or transformation programs in enterprise environments is a plus
What we offer:
- Competitive high salary (pegged to EUR)
- Full-time employment as an internal employee of SIXT TECH Ukraine
- Relocation compensation
- People-oriented management with minimal bureaucracy
- A challenging role where you can learn, grow, and influence architecture and processes
- 25 calendar days of paid vacation
- Educational budget for courses, conferences, and certificationsMedical insurance
- Co-funding (50%) for gym and foreign language classes
If you want to work with modern data tech, real business impact, and a global product at scale — we’d love to hear from you.
Відгукнутись на вакансію