logo[мetahunt]
> DOU
middle

Full Stack Engineer

TechMagic
format:Remotecompany:Outsource
node.jsjavascripttypescriptreactawssql
terraformaws cdk
englishB2
experience3+ years
domainHealthTech
> full description

We are looking for a strong Middle Full-Stack Engineer (Node.js) with 3+ years of experience to join our Medplum direction and grow into a project team through a structured onboarding program.

You will start with an internal Medplum-focused bootcamp, followed by a hands-on pet project, and then transition to one of our ongoing healthcare projects, where you will act as a technical consultant and contributor.

Requirements:

Must have:

  • 3+ years of commercial experience with JavaScript / TypeScript
  • 3+ years of commercial experience with Node.js
  • Experience with at least one modern front-end framework (React, Angular, Vue, etc.)
  • Experience with AWS
  • Experience with SQL and/or NoSQL databases
  • Experience in healthcare domain (FHIR, Medplum, etc.)
  • English level: Upper-intermediate

Nice to have:

  • Experience with AI tools and spec-driven development
  • Experience with IaaS (AWS CDK, Terraform, or alternatives)
  • Experience with AI integrations

Key Responsibilities:

  • Complete internal Medplum bootcamp and gain domain expertise in healthcare solutions
  • Develop a pet project to apply acquired knowledge in practice
  • Implement and maintain scalable web applications
  • Participate in discovery phases, estimations, and technical planning
  • Perform research and prototyping for new ideas and solutions
  • Contribute to pre-sales activities and technical consulting
  • Start and support new projects from scratch

Project

Customer: Multiple healthcare clients (USA/EU-based startups)

Type: Healthcare / SaaS

Product:

We are working on several healthcare platforms built on top of Medplum — an open-source platform for building healthcare applications using FHIR standards. These solutions focus on patient data management, clinical workflows, and integrations between healthcare systems.

Market: US & EU healthcare market

Stage: Ongoing projects and active growth of Medplum expertise within the company

Work schedule: Full-time working day, the full remote is available.

Onboarding program:

  • 1st month: Structured Medplum bootcamp with mentorship
  • 2nd month: Development of an internal pet project
  • Next steps: Allocation to a commercial project

Interview stages:

  • Call with the recruiter
  • Technical interview
Відгукнутись на вакансію