> DOUArtkai
Full Stack Engineer
format:Remotecompany:Outstaff
pythonfastapisqlalchemyceleryreactkubernetesrest-apidockerpostgresql
claude codegithub copilot
> full description
About Artkai
At Artkai, we partner with mid-market and enterprise businesses to modernize software, streamline operations, and deliver secure, enterprise-grade technology solutions. Combining senior-level engineering with cutting-edge AI capabilities, we drive measurable business outcomes without compromising on security or governance.
Project Overview
- Format: Outstaff, long-term (6+ months).
- Domain: AdTech / MarTech platform for digital ad campaign management & optimization across multiple channels.
- Stage: Implementation (adding new channels, platform integrations, data optimization models in collaboration with Data Science teams).
Scope & Responsibilities
- Consolidate policy engines, wallet registries, and governance frameworks into a single system.
- Build backend capabilities for wallet management, transaction construction, execution pipelines, and signing coordination.
- Develop REST APIs, async background task pipelines, and relational database schemas.
- Handle full-stack tasks end-to-end (strong backend focus with React frontend support when required).
Requirements
- Tech Stack: Python, FastAPI, SQLAlchemy, Celery, React, Kubernetes.
- Core Skills: Backend architecture, API design, relational DBs, async/background processing, testing, containerization/cloud.
- Nice to Have: Hands-on experience with AI-assisted development tools (Claude Code, GitHub Copilot).
- Time Zone: European time zone preferred (CET ±2 hrs).
- English Level: Advanced / C1 (fluent technical & verbal communication).