logo[мetahunt]
> DOU
senior

Software Engineer

Kultprosvet
format:Hybridcompany:Outsource
phplaravelmysqlrest-apigraphqlaws
node.js
englishB2
experience5+ years
domainSaaS
locationDnipro, Ukraine
> full description

Hey! We are Kultprosvet, a team of web and mobile software developers who care. Now we’re expanding and welcome talented Senior Backend Engineer (PHP/Laravel) to join our team.

About the project:

We’re developing a powerful gifting SaaS platform that helps companies and individuals easily send gifts at scale — for employee rewards, customer engagement, and special occasions.

Requirements:

  • 5+ years of backend software engineering experience, with strong senior-level ownership;
  • Strong PHP skills and solid hands-on Laravel experience;
  • Deep understanding of MySQL / relational databases, including schema design, transactions, migrations, and query optimization;
  • Strong experience building and maintaining production APIs (REST or GraphQL, authentication, integrations, versioning);
  • Experience working with production systems, including debugging complex issues, logging, monitoring, and incident resolution;
  • Strong understanding of reliability, scalability, and performance in production environments;
  • Experience with safe deployments, release processes, and troubleshooting production issues;
  • Ability to work effectively with an existing/mature codebase, identify technical risks, and improve it incrementally;
  • Strong engineering practices: code reviews, testing, PR workflows, clean and maintainable code;
  • Strong ownership mindset — ability to take a problem from investigation and solution design through implementation, rollout, and monitoring;
  • Good frontend awareness — ability to understand modern frontend architecture and collaborate effectively with frontend engineers;
  • Familiarity with AWS environments and deployment concepts;
  • Experience using AI-assisted development tools as part of the engineering workflow;
  • Strong communication and collaboration skills;
  • English: Upper-Intermediate (B2) or higher.

What You’ll Do:

  • Build and maintain backend features, services, and APIs using PHP / Laravel;
  • Work with both the existing platform and contribute to its ongoing technical evolution and modernization;
  • Design reliable flows around integrations, gift lifecycle/state, and operational tooling;
  • Implement and maintain background jobs, asynchronous processing, retries, and failure handling;
  • Investigate and resolve complex production issues and help improve overall system stability;
  • Improve application performance and data quality through MySQL optimization, schema improvements, and safe migrations;
  • Collaborate closely with frontend engineers and product/design teams on API contracts and end-to-end delivery;
  • Raise the engineering quality bar through code reviews, testing practices, technical discussions, and pragmatic refactoring;
  • Take ownership of a domain from problem → solution → rollout → monitoring → iteration;
  • Support and mentor other engineers and contribute to technical decisions and engineering standards;
  • Gradually expand your knowledge across the platform, including newer Node.js-based components.

What we offer:

  • Competitive compensation: depending on experience and qualifications;
  • Flexible work setup — remote or from our office in Dnipro;
  • Opportunity to make a direct impact on product growth and key business metrics;
  • Comprehensive benefits, including medical insurance, full accounting support, a budget for courses, conferences, and professional development, plus coverage for psychotherapy sessions because your well-being matters.

💡 Ready to work on meaningful products and grow with us? Let’s connect! 🚀

Відгукнутись на вакансію