logo[мetahunt]
> DOU

Software Engineer

Web Legends
format:Remotecompany:Product
.netreactnext.jspostgresqlentity framework core
fastapisqlalchemyhangfireshadcn/ui
englishB1
experience3+ years
domainFintech
locationLisbon, Portugal
> full description

We’re looking for a motivated Full Stack Developer with strong .NET and React/Next.js skills to join a small team building advanced document processing and data extraction solutions for the insurance domain. You’ll work on a web application that uses large language models to parse complex documents, extract structured information, and present it through a clean, responsive interface.

What You’ll Do

  • Build and improve frontend features in Next.js, using Tailwind CSS, shadcn/ui, and TanStack, with authentication handled through Clerk
  • Develop and maintain backend services in .NET, using Wolverine for messaging, Hangfire for background jobs, and Entity Framework over PostgreSQL
  • Work within a modular monolith built on clean architecture and DDD principles
  • Integrate real-time communication with Ably to keep users updated
  • Leverage LLMs and AI tools (e.g. Claude) to improve your own development speed, code quality, and productivity
  • Own tasks end to end — from requirements through deployment to feature and production environments
  • Keep code tested (with automated testing), secure, and clean
  • Collaborate closely with ML developers and QA in daily stand-ups and sprint planning, delivering every sprint

Must-Have Skills

  • Solid backend experience with .NET (or a strong, transferable background you can quickly adapt from)
  • Experience with clean architecture, DDD, and modular monolith design
  • Strong frontend skills with React / Next.js
  • Familiarity with PostgreSQL and an ORM such as Entity Framework
  • Experience with real-time communication tools such as Ably
  • Comfortable in a small, fast-paced, agile team with frequent delivery
  • Eager to learn, adaptable, and able to keep up with a quick workflow
  • A team player who helps others — strong communication is important here
  • At least 3 years of commercial experience
  • Intermediate English proficiency

Nice to Have

  • Experience with large language models and AI-powered data extraction
  • Familiarity with Wolverine, Hangfire, Clerk, shadcn/ui, or TanStack
  • Python knowledge — FastAPI and SQLAlchemy a plus
  • A creative streak and comfort using design tools like Claude Design, v0, or Lovable
  • Knowledge of enterprise system integrations, especially in insurance or healthcare
  • Understanding of document parsing and structured data workflows Interest in automating complex business processes and improving data accuracy

We Offer

  • Flexible schedule
  • Horizontal management and communication directly with project stakeholders
  • 20 days of paid vacation
  • Paid sick-leaves
  • Annual activities budget — we endorse your wish to self-improvement
  • Remote work
Відгукнутись на вакансію