> DOUWeb Legends
Software Engineer
format:Remotecompany:Product
.netreactnext.jspostgresqlentity framework core
fastapisqlalchemyhangfireshadcn/ui
> full description
We’re looking for a motivated Full Stack Developer with strong .NET and React/Next.js skills to join a small team building advanced document processing and data extraction solutions for the insurance domain. You’ll work on a web application that uses large language models to parse complex documents, extract structured information, and present it through a clean, responsive interface.
What You’ll Do
- Build and improve frontend features in Next.js, using Tailwind CSS, shadcn/ui, and TanStack, with authentication handled through Clerk
- Develop and maintain backend services in .NET, using Wolverine for messaging, Hangfire for background jobs, and Entity Framework over PostgreSQL
- Work within a modular monolith built on clean architecture and DDD principles
- Integrate real-time communication with Ably to keep users updated
- Leverage LLMs and AI tools (e.g. Claude) to improve your own development speed, code quality, and productivity
- Own tasks end to end — from requirements through deployment to feature and production environments
- Keep code tested (with automated testing), secure, and clean
- Collaborate closely with ML developers and QA in daily stand-ups and sprint planning, delivering every sprint
Must-Have Skills
- Solid backend experience with .NET (or a strong, transferable background you can quickly adapt from)
- Experience with clean architecture, DDD, and modular monolith design
- Strong frontend skills with React / Next.js
- Familiarity with PostgreSQL and an ORM such as Entity Framework
- Experience with real-time communication tools such as Ably
- Comfortable in a small, fast-paced, agile team with frequent delivery
- Eager to learn, adaptable, and able to keep up with a quick workflow
- A team player who helps others — strong communication is important here
- At least 3 years of commercial experience
- Intermediate English proficiency
Nice to Have
- Experience with large language models and AI-powered data extraction
- Familiarity with Wolverine, Hangfire, Clerk, shadcn/ui, or TanStack
- Python knowledge — FastAPI and SQLAlchemy a plus
- A creative streak and comfort using design tools like Claude Design, v0, or Lovable
- Knowledge of enterprise system integrations, especially in insurance or healthcare
- Understanding of document parsing and structured data workflows Interest in automating complex business processes and improving data accuracy
We Offer
- Flexible schedule
- Horizontal management and communication directly with project stakeholders
- 20 days of paid vacation
- Paid sick-leaves
- Annual activities budget — we endorse your wish to self-improvement
- Remote work