logo[мetahunt]
> DOU
middle

Backend Engineer

Suntech Innovation
format:Remotecompany:Product
javaspringjunitmysqlrest-apigitgradlemaven
groovyhibernateawsnode.jsangularionicrabbitmqkafkalinux
domainiGaming
locationKyiv, Ukraine
> full description

About us:
We are a product R&D company that creates solutions for the dynamic iGaming Ecosystem.
Our mission is to build cutting-edge platforms that reinvent the iGaming industry.

About product

A scalable, feature-rich iGaming platform focused on continuous product evolution and high-quality user experience. The system is built on a modern technology stack, the teams are focused on long-term product growth, stability, and innovation, working in a mature Agile environment with a strong technical culture.

Product Technical Stack:
Backend: Java 11/21, Spring Boot 2.2/3.0
Frontend: Angular 19/20, React.js
Databases & Messaging: MySQL, Kafka, RabbitMQ, Redis
Cloud & Containerization: AWS, Docker, K8s
Architecture: Highload Systems, Microservices, Serverless, CDN
Monitoring & Analytics: Grafana, ELK stack, and Big Data solutions

Team description:
You will join a cross-functional squad of 6 engineers (FE/BE/QA), working closely with a Product Owner, Architect, and Tech Lead. The team is responsible for developing and maintaining key platform services, delivering new features, and ensuring the reliability and scalability of the system.

As a Middle Back-End Developer, you will work in a high-load and integration-heavy environment, contributing to the development and maintenance of platform services. The role involves building and improving backend components, supporting integrations with external providers and internal services, including personalization features and distributed configuration systems, while collaborating with experienced engineers across the teams.

Responsibilities:

  • Writing backend code and tests as well as leveraging open source technologies to get reliable results;
  • Improving code quality through testing, refactoring, peer-reviews;
  • Working effectively in an agile team using Scrum;
  • Collaborating with business stakeholders and internal users to design and deliver products that attract new customers and keep them coming back;
  • Performing root cause analysis to ensure that mistakes are properly understood and not repeated;
  • Contributing to coding standards and guidelines as well as setting a good example of adhering to them;
  • Standing by your solutions to ensure that both you and the team have the tools and ability to support its operation after hours.

Requirements:

  • Extensive knowledge of Java, Spring and associated technologies: JUnit, Web Application Servers (e.g. Jetty/Tomcat), Gradle/Maven;
  • Strong knowledge of MySQL and writing optimized database queries;
  • Thorough understanding of architectural software concepts, Object-Oriented and Functional programming, MVC/MV* architectures, asynchronous server communication;
  • Experience in the design and development of RESTful web services and JSON handling;
  • Able to use Git and understand distributed version control strategies;
  • Software craftsman, with a rigorous and disciplined approach to writing simple and effective software but not afraid to learn from failure and tell others about mistakes;
  • Knowledgeable in web software architectures and design patterns;
  • TDD, Refactoring;
  • Familiar with using a tracking system such as JIRA;
  • Have an aptitude and willingness to learn the business domain and new technologies;
  • A genuinely nice person, opinionated but humble enough to work with anyone.

Desirable:

  • Familiar with Groovy, Spock, Hibernate, Spring Boot;
  • Have used cloud services like AWS or Google App Engine;
  • Experience of integrating backend services with NodeJS, Angular, Ionic or a similar framework for mobile site development;
  • Knowledge of multi-threaded programming and concurrency;
  • Practical experience with message brokers such as RabbitMQ, Apache Kafka;
  • Delivering scalable and high-traffic-resilient applications with optimized content delivery using CDN like Fastly;
  • Comfortable working in a Linux environment with scripting languages;

You will get:

  • Work in a technically strong environment with modern stack and mature Agile culture;
  • High autonomy, decision-making authority, and close cooperation with leadership;
  • A position in a product development company with a dynamic environment and several concurrent projects;
  • Opportunity to contribute (your ideas for improvement implementation);
  • Continuous self-improvement and growth, including budget for certifications and courses;
  • Competitive salary plus financial bonuses;
  • Medical insurance coverage;
  • English language courses;
  • Wellbeing package: online-yoga classes, Yakaboo, BetterMe App: Health Coaching, BetterMe App: Mental Health;
  • Corporate events and fun team-building activities.
  • Remote-first culture

Interview Stages:

  1. HR Interview (45-60 minutes) — Initial conversation to discuss your experience, career goals, and cultural fit.
  2. Technical task (optional)
  3. Technical Interview (1,5 hour) — In-depth technical interview covering relevant skills.
  4. Final Interview (1 hour) — A comprehensive discussion with the team, focusing on role-specific competencies and alignment with company values.
  5. Reference check & Job Offer
Відгукнутись на вакансію